PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_02485.1_g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 563aa    MW: 62812.5 Da    PI: 4.8015
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_02485.1_g00006.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.31.5e-49131392128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                              +pGfrFhPtdeelvv+yLk+k+ g+kl++ ++i  vdiyk++P++Lp  + +k+++++w+fF++r++ky++  r+ r t++gyWka
  Rsa1.0_02485.1_g00006.1  13 APGFRFHPTDEELVVYYLKRKICGRKLRI-NAIGVVDIYKLDPSELPrlSVLKSGDRQWFFFTPRNRKYPNAARSGRCTATGYWKA 97 
                              69***************************.89***************544788899****************************** PP

                      NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              tgkd+ ++  +++ vglkktLvfy+grap+ge+tdWvmhey++
  Rsa1.0_02485.1_g00006.1  98 TGKDRVIVY-NSRSVGLKKTLVFYRGRAPSGERTDWVMHEYTM 139
                              ********9.999****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100552.54512162IPR003441NAC domain
SuperFamilySSF1019411.57E-5513162IPR003441NAC domain
PfamPF023654.3E-2614138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MANSCLKGGK FSAPGFRFHP TDEELVVYYL KRKICGRKLR INAIGVVDIY KLDPSELPRL  60
SVLKSGDRQW FFFTPRNRKY PNAARSGRCT ATGYWKATGK DRVIVYNSRS VGLKKTLVFY  120
RGRAPSGERT DWVMHEYTMD EEELGRCKNA KEYYALYKLY KKSGAGPKNG EEYGAPFQEE  180
EWVDHDDDDD VAVPDDHVVR YENNPPPVGD GLLCNPVSIQ SDDLDKLLNE IPNAPGVVAQ  240
RQMNELSGVL QGISEEDIES VLLNNPPGES LVPWDVGKAL PNSHWSFQSN MRSANSFEAT  300
EVKSAFNTSG IAPLVFDKED YIEMDDLLTP ELGASSVEKP TQFSNPGEYG DFNDFDQLFR  360
EVSMSLDMEP ISQEASLSSV SVNDGRQFLY QQQFQDQTFE NKLNSFMDTN TNVDQFTEDM  420
WFKDAQAYLY DQPQSYSLAP SSGVMPESTN PTMSVDGQNQ GGQNVGGGTR SQFSSAMLAW  480
MDSIPSTPAS ACEGPLNRTF VRMSSLSRIR FNGTSVTASK VTVAKKRIRN RGLFVLSIVG  540
ALCAIFWVFI IATVGVLGRP VLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-451413917140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013638215.10.0PREDICTED: NAC domain-containing protein 16-like
SwissprotA4FVP60.0NAC16_ARATH; NAC domain-containing protein 16
TrEMBLA0A078CAS50.0A0A078CAS5_BRANA; BnaC05g28020D protein
STRINGBra034439.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34180.10.0NAC domain containing protein 16